PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009792999.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 435aa    MW: 49147 Da    PI: 5.1829
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009792999.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS311.71.6e-95434231373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl..fsevsPilkf 93 
                     l++lLl+cA+a++++d +laq++++ l++las++gdp+qRl++ f++AL +r +r +++  +     +++  ++ + +++++l  ++++ P+++f
  XP_009792999.1  43 LEKLLLHCANALENNDVTLAQQVMWVLNNLASSNGDPNQRLTSWFLRALISRASRVCPTATNNYLYGSSN-LDQRRLMSVTELagYVDLIPWHRF 136
                     5799***************************************************888887766554444.33455555555577********** PP

            GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvl.... 181
                     ++ + N aI++a+eg+++vHi+Df+i++++QWp+L++a+a+RpegppslRi + +   s+    + + ee+g rLa+fA+  +vpfef+v+    
  XP_009792999.1 137 GFCASNGAIYKAIEGHTKVHILDFSITHCMQWPTLIDAIAKRPEGPPSLRISVPSWRPSVppfINVSSEEVGLRLANFAKFRDVPFEFQVIedln 231
                     ****************************************************9888666688999*************************96653 PP

            GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                     +   l++l++++L+++ +Eal+Vn++  l +++de+ + +s   rd +L+ vk+l+P +++vv++++d++++s+  r++ +++y +  fd+le+ 
  XP_009792999.1 232 YDMLLSQLSPSTLQLRDDEALVVNCQNWLRYMPDEQIKGSSisSRDIFLDRVKELNPCILTVVDEDSDLGNSSLTSRLATCFNYLWIPFDALETF 326
                     33367788***************************987666669*************************************************** PP

            GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                     lp++s++r  +E+  +g +i+n++  eg +r+er e+ +k ++r+e++GF +v++ e++ k++k+ll +++  g+ +++e++ lvl+Wk+++ v 
  XP_009792999.1 327 LPKDSRQRLDYEAD-IGHRIENIIGFEGVQRIERLERCNKFSQRMENSGFMSVSFCEETIKEVKSLLDEHA-SGWGMKKEDDMLVLTWKGHNSVY 419
                     **************.********************************************************.8999******************* PP

            GRAS 370 vSaW 373
                     ++aW
  XP_009792999.1 420 ATAW 423
                     **** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.90317405IPR005202Transcription factor GRAS
PfamPF035145.6E-9343423IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MKAELRGTST TIPLQNSSLF NNPQNSLAGA LKGCIGNLDG ACLEKLLLHC ANALENNDVT  60
LAQQVMWVLN NLASSNGDPN QRLTSWFLRA LISRASRVCP TATNNYLYGS SNLDQRRLMS  120
VTELAGYVDL IPWHRFGFCA SNGAIYKAIE GHTKVHILDF SITHCMQWPT LIDAIAKRPE  180
GPPSLRISVP SWRPSVPPFI NVSSEEVGLR LANFAKFRDV PFEFQVIEDL NYDMLLSQLS  240
PSTLQLRDDE ALVVNCQNWL RYMPDEQIKG SSISSRDIFL DRVKELNPCI LTVVDEDSDL  300
GNSSLTSRLA TCFNYLWIPF DALETFLPKD SRQRLDYEAD IGHRIENIIG FEGVQRIERL  360
ERCNKFSQRM ENSGFMSVSF CEETIKEVKS LLDEHASGWG MKKEDDMLVL TWKGHNSVYA  420
TAWVLVPPQM DTRIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-29474238374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755190.0HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009792999.10.0PREDICTED: scarecrow-like protein 32
RefseqXP_016470911.10.0PREDICTED: scarecrow-like protein 32
TrEMBLM1CH560.0M1CH56_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000673600.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA103032227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-127GRAS family protein